Review



recombinant rat il 6 rril 6  (R&D Systems)


Bioz Verified Symbol R&D Systems is a verified supplier
Bioz Manufacturer Symbol R&D Systems manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 94
      Buy from Supplier

    Structured Review

    R&D Systems recombinant rat il 6 rril 6
    Recombinant Rat Il 6 Rril 6, supplied by R&D Systems, used in various techniques. Bioz Stars score: 94/100, based on 70 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+rat+il+6+rril+6/Recombinant+Rat+IL-6+Protein/pmc09113206-181-11-20
    Average 94 stars, based on 70 article reviews
    recombinant rat il 6 rril 6 - by Bioz Stars, 2026-09
    94/100 stars

    Images

    Related Articles

    Recombinant:

    Article Title: Fadu head and neck squamous cell carcinoma induces hyperexcitability of primary sensory neurons in an in vitro coculture model
    Article Snippet: .. For IL-6 experiments, DRG neurons were treated with 60 ng of recombinant rat IL-6 (rrIL-6) or recombinant human IL-6 (rhIL-6; R&D Systems, Minneapolis, MN), using either direct application to the bath solution during recording or a 1-hour incubation period before recording. ..

    Article Title: Transcriptional activation of endothelial cells by TGFβ coincides with acute microvascular plasticity following focal spinal cord ischaemia/reperfusion injury
    Article Snippet: IGFBP-3 , Perivascular astrocytic endfeet(1:50) , Synthetic peptide corresponding to amino acids 241–291 within the C-terminus of mouse IGFBP-3 (DKKGFYKKKRCRPSKGRKQSFCWCVDKYGQRLPGYDTKGKDDVHCLSV QSQ-C) , Goat poly-IgG , M-19; sc-6004/Santa Cruz Biotechnology , Single 42 kDa band on immunoblot ( ) . .. IL-6 , Perivascular astrocytic endfeet(1:50) , Recombinant rat IL-6 (rrIL-6) derived from Escherichia coli , Goat poly-IgG , AF506; lot # BCZ04/R&D Systems , Single 27 kDa band on immunoblot ( ) . .. RECA-1 , Rat ECs (1:25) , Stromal cells from rat lymph node , Mouse mono-IgG , MCA970GR/Serotec , Not appropriate for immunoblot ( ) .

    Article Title: Induction of functional anaphylatoxin C5a receptors on hepatocytes by in vivo treatment of rats with IL-6.
    Article Snippet: .. Recombinant human IL-6 (rhIL-6) was purchased from Pharma Biotechnologie (Hannover, Germany), and recombinant rat IL-6 (rrIL-6) was obtained from R&D Systems (Wiesbaden, Germany). .. Percoll was obtained from Pharmacia (Freiburg, Germany); M199 was obtained from AppliChem (Darmstadt, Germany); newborn calf serum (NCS) was obtained from PAA Laboratories (Cölbe, Germany); dexamethasone and indomethacin was obtained from Sigma (Deisenhofen, Germany); and insulin, penicillin, streptomycin sulfate, and noradrenaline (NA) was obtained from Serva (Heidelberg, Germany).

    Incubation:

    Article Title: Fadu head and neck squamous cell carcinoma induces hyperexcitability of primary sensory neurons in an in vitro coculture model
    Article Snippet: .. For IL-6 experiments, DRG neurons were treated with 60 ng of recombinant rat IL-6 (rrIL-6) or recombinant human IL-6 (rhIL-6; R&D Systems, Minneapolis, MN), using either direct application to the bath solution during recording or a 1-hour incubation period before recording. ..

    Derivative Assay:

    Article Title: Transcriptional activation of endothelial cells by TGFβ coincides with acute microvascular plasticity following focal spinal cord ischaemia/reperfusion injury
    Article Snippet: IGFBP-3 , Perivascular astrocytic endfeet(1:50) , Synthetic peptide corresponding to amino acids 241–291 within the C-terminus of mouse IGFBP-3 (DKKGFYKKKRCRPSKGRKQSFCWCVDKYGQRLPGYDTKGKDDVHCLSV QSQ-C) , Goat poly-IgG , M-19; sc-6004/Santa Cruz Biotechnology , Single 42 kDa band on immunoblot ( ) . .. IL-6 , Perivascular astrocytic endfeet(1:50) , Recombinant rat IL-6 (rrIL-6) derived from Escherichia coli , Goat poly-IgG , AF506; lot # BCZ04/R&D Systems , Single 27 kDa band on immunoblot ( ) . .. RECA-1 , Rat ECs (1:25) , Stromal cells from rat lymph node , Mouse mono-IgG , MCA970GR/Serotec , Not appropriate for immunoblot ( ) .

    Western Blot:

    Article Title: Transcriptional activation of endothelial cells by TGFβ coincides with acute microvascular plasticity following focal spinal cord ischaemia/reperfusion injury
    Article Snippet: IGFBP-3 , Perivascular astrocytic endfeet(1:50) , Synthetic peptide corresponding to amino acids 241–291 within the C-terminus of mouse IGFBP-3 (DKKGFYKKKRCRPSKGRKQSFCWCVDKYGQRLPGYDTKGKDDVHCLSV QSQ-C) , Goat poly-IgG , M-19; sc-6004/Santa Cruz Biotechnology , Single 42 kDa band on immunoblot ( ) . .. IL-6 , Perivascular astrocytic endfeet(1:50) , Recombinant rat IL-6 (rrIL-6) derived from Escherichia coli , Goat poly-IgG , AF506; lot # BCZ04/R&D Systems , Single 27 kDa band on immunoblot ( ) . .. RECA-1 , Rat ECs (1:25) , Stromal cells from rat lymph node , Mouse mono-IgG , MCA970GR/Serotec , Not appropriate for immunoblot ( ) .



    Similar Products

    recombinant rat il-6 protein (rril-6  (Cloud-Clone corp)
    90
    Cloud-Clone corp recombinant rat il-6 protein (rril-6
    <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn following VPA treatment. (A) and (C) represent each experimental design and time of tissue collection. (B) VPA <t>down-regulated</t> <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn induced by orofacial inflammation combined with FS stress. * P < 0.05 vs the CFA+FS+Saline group. (D) VPA did not affect the expression of IL-6 in the spinal dorsal horn of naïve rats. ns, non-significant.
    Recombinant Rat Il 6 Protein (Rril 6, supplied by Cloud-Clone corp, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+rat+il+6+rril+6/recombinant+rat+il+6+protein++rril+6/pmc10926348-44-0-5
    Average 90 stars, based on 1 article reviews
    recombinant rat il-6 protein (rril-6 - by Bioz Stars, 2026-09
    90/100 stars
    		  Buy from Supplier
    recombinant rat il 6 rril 6  (R&D Systems)
    94
    R&D Systems recombinant rat il 6 rril 6
    <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn following VPA treatment. (A) and (C) represent each experimental design and time of tissue collection. (B) VPA <t>down-regulated</t> <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn induced by orofacial inflammation combined with FS stress. * P < 0.05 vs the CFA+FS+Saline group. (D) VPA did not affect the expression of IL-6 in the spinal dorsal horn of naïve rats. ns, non-significant.
    Recombinant Rat Il 6 Rril 6, supplied by R&D Systems, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+rat+il+6+rril+6/Recombinant+Rat+IL-6+Protein/pmc09113206-181-11-20
    Average 94 stars, based on 1 article reviews
    recombinant rat il 6 rril 6 - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    rril 6  (R&D Systems)
    94
    R&D Systems rril 6
    <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn following VPA treatment. (A) and (C) represent each experimental design and time of tissue collection. (B) VPA <t>down-regulated</t> <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn induced by orofacial inflammation combined with FS stress. * P < 0.05 vs the CFA+FS+Saline group. (D) VPA did not affect the expression of IL-6 in the spinal dorsal horn of naïve rats. ns, non-significant.
    Rril 6, supplied by R&D Systems, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+rat+il+6+rril+6/Recombinant+Rat+IL-6+Protein/pmc03020368-93-5-17
    Average 94 stars, based on 1 article reviews
    rril 6 - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    rat recombinant il 6 rril 6  (R&D Systems)
    94
    R&D Systems rat recombinant il 6 rril 6
    <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn following VPA treatment. (A) and (C) represent each experimental design and time of tissue collection. (B) VPA <t>down-regulated</t> <t>IL-6</t> expression in the L4-L5 segments of spinal dorsal horn induced by orofacial inflammation combined with FS stress. * P < 0.05 vs the CFA+FS+Saline group. (D) VPA did not affect the expression of IL-6 in the spinal dorsal horn of naïve rats. ns, non-significant.
    Rat Recombinant Il 6 Rril 6, supplied by R&D Systems, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+rat+il+6+rril+6/Recombinant+Rat+IL-6+Protein/pm18214991-39-12-19
    Average 94 stars, based on 1 article reviews
    rat recombinant il 6 rril 6 - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier

    Image Search Results


    IL-6 expression in the L4-L5 segments of spinal dorsal horn following VPA treatment. (A) and (C) represent each experimental design and time of tissue collection. (B) VPA down-regulated IL-6 expression in the L4-L5 segments of spinal dorsal horn induced by orofacial inflammation combined with FS stress. * P < 0.05 vs the CFA+FS+Saline group. (D) VPA did not affect the expression of IL-6 in the spinal dorsal horn of naïve rats. ns, non-significant.

    Journal: Brain research bulletin

    Article Title: Valproate attenuates somatic hyperalgesia induced by orofacial inflammation combined with stress through inhibiting spinal IL-6 and STAT1 phosphorylation

    doi: 10.1016/j.brainresbull.2024.110889

    Figure Lengend Snippet: IL-6 expression in the L4-L5 segments of spinal dorsal horn following VPA treatment. (A) and (C) represent each experimental design and time of tissue collection. (B) VPA down-regulated IL-6 expression in the L4-L5 segments of spinal dorsal horn induced by orofacial inflammation combined with FS stress. * P < 0.05 vs the CFA+FS+Saline group. (D) VPA did not affect the expression of IL-6 in the spinal dorsal horn of naïve rats. ns, non-significant.

    Article Snippet: Recombinant rat IL-6 protein (rrIL-6, Cloud-Clone Corp., Wuhan, China) was dissolved into the dose of 20 ng/10 μL with saline (0.9%), which was administered intrathecally.

    Techniques: Expressing, Saline

    Intrathecal injection of rrIL-6 reversed anti-nociceptive effect of VPA on somatic hyperalgesia induced by orofacial inflammation combined with FS stress. (A) Experimental design for single injection of rrIL-6 and behavior tests of the thermal withdrawal latency and mechanical withdrawal threshold. (B) Experimental design for consecutive injection of rrIL-6 and timeline of the thermal withdrawal latency and mechanical withdrawal threshold. Rats were treated with VPA or saline intraperitoneally for 5 days, rrIL-6/saline were administered intrathecally 1 h after last VPA injection for single injection of rrIL-6 or 5 day consecutive injection of rrIL-6 after last FS. The behavioral tests for thermal withdrawal latency and mechanical withdrawal threshold were assessed before and after rrIL-6 injection. d, day; T, thermal withdrawal latency; M, mechanical withdrawal threshold; CFA, complete Freund’s adjuvant; FS, forced swim; VPA, valproate; rrIL-6, recombinant rat IL-6. (C, D) The mechanical withdrawal threshold (C) and thermal withdrawal latency (D) were significantly decreased after single injection of rrIL-6. (E, F) The mechanical withdrawal threshold (E) and thermal withdrawal latency (F) were significantly decreased after consecutive injection of rrIL-6. *, ***, **** P < 0.05, 0.001, 0.0001 vs pre-IL-6, respectively. # , ## , ### , #### P < 0.05, 0.01, 0.001, 0.0001 vs the CFA+FS+VPA+Saline group at the same time point, respectively.

    Journal: Brain research bulletin

    Article Title: Valproate attenuates somatic hyperalgesia induced by orofacial inflammation combined with stress through inhibiting spinal IL-6 and STAT1 phosphorylation

    doi: 10.1016/j.brainresbull.2024.110889

    Figure Lengend Snippet: Intrathecal injection of rrIL-6 reversed anti-nociceptive effect of VPA on somatic hyperalgesia induced by orofacial inflammation combined with FS stress. (A) Experimental design for single injection of rrIL-6 and behavior tests of the thermal withdrawal latency and mechanical withdrawal threshold. (B) Experimental design for consecutive injection of rrIL-6 and timeline of the thermal withdrawal latency and mechanical withdrawal threshold. Rats were treated with VPA or saline intraperitoneally for 5 days, rrIL-6/saline were administered intrathecally 1 h after last VPA injection for single injection of rrIL-6 or 5 day consecutive injection of rrIL-6 after last FS. The behavioral tests for thermal withdrawal latency and mechanical withdrawal threshold were assessed before and after rrIL-6 injection. d, day; T, thermal withdrawal latency; M, mechanical withdrawal threshold; CFA, complete Freund’s adjuvant; FS, forced swim; VPA, valproate; rrIL-6, recombinant rat IL-6. (C, D) The mechanical withdrawal threshold (C) and thermal withdrawal latency (D) were significantly decreased after single injection of rrIL-6. (E, F) The mechanical withdrawal threshold (E) and thermal withdrawal latency (F) were significantly decreased after consecutive injection of rrIL-6. *, ***, **** P < 0.05, 0.001, 0.0001 vs pre-IL-6, respectively. # , ## , ### , #### P < 0.05, 0.01, 0.001, 0.0001 vs the CFA+FS+VPA+Saline group at the same time point, respectively.

    Article Snippet: Recombinant rat IL-6 protein (rrIL-6, Cloud-Clone Corp., Wuhan, China) was dissolved into the dose of 20 ng/10 μL with saline (0.9%), which was administered intrathecally.

    Techniques: Injection, Saline, Adjuvant, Recombinant